![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
![]() | Protein Chorismate mutase domain of P-protein [48602] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries) Uniprot Q5SLA5 3-82 |
![]() | Domain d2d8da1: 2d8d A:3-82 [131329] complexed with cl |
PDB Entry: 2d8d (more details), 1.15 Å
SCOPe Domain Sequences for d2d8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8da1 a.130.1.1 (A:3-82) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]} eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp gpfpdetirklfkeifkasl
Timeline for d2d8da1: