Lineage for d2d8da1 (2d8d A:3-82)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749889Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 1749890Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 1749891Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 1749892Protein Chorismate mutase domain of P-protein [48602] (2 species)
  7. 1749896Species Thermus thermophilus [TaxId:274] [140937] (2 PDB entries)
    Uniprot Q5SLA5 3-82
  8. 1749897Domain d2d8da1: 2d8d A:3-82 [131329]
    complexed with cl

Details for d2d8da1

PDB Entry: 2d8d (more details), 1.15 Å

PDB Description: Structure of Chorismate Mutase (Form I) from Thermus Thermophilus HB8
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase

SCOPe Domain Sequences for d2d8da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8da1 a.130.1.1 (A:3-82) Chorismate mutase domain of P-protein {Thermus thermophilus [TaxId: 274]}
eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
gpfpdetirklfkeifkasl

SCOPe Domain Coordinates for d2d8da1:

Click to download the PDB-style file with coordinates for d2d8da1.
(The format of our PDB-style files is described here.)

Timeline for d2d8da1: