Lineage for d2d82a1 (2d82 A:1077-1197)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639850Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 639851Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 639852Protein CREB-binding protein, CBP [74712] (1 species)
  7. 639853Species Human (Homo sapiens) [TaxId:9606] [74713] (2 PDB entries)
  8. 639855Domain d2d82a1: 2d82 A:1077-1197 [131327]
    automatically matched to d1jspb_
    complexed with ttr

Details for d2d82a1

PDB Entry: 2d82 (more details)

PDB Description: Target Structure-Based Discovery of Small Molecules that Block Human p53 and CREB Binding Protein (CBP) Association
PDB Compounds: (A:) creb-binding protein

SCOP Domain Sequences for d2d82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d82a1 a.29.2.1 (A:1077-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

SCOP Domain Coordinates for d2d82a1:

Click to download the PDB-style file with coordinates for d2d82a1.
(The format of our PDB-style files is described here.)

Timeline for d2d82a1: