Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins) |
Protein Viral RNA polymerase [56695] (9 species) |
Species Foot-and-mouth disease virus [TaxId:12110] [111302] (4 PDB entries) |
Domain d2d7sa1: 2d7s A:1-474 [131326] automatically matched to d1u09a_ |
PDB Entry: 2d7s (more details), 3 Å
SCOP Domain Sequences for d2d7sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7sa1 e.8.1.4 (A:1-474) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]} glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaale
Timeline for d2d7sa1: