Lineage for d2d7sa1 (2d7s A:1-474)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743413Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 743421Protein Viral RNA polymerase [56695] (9 species)
  7. 743429Species Foot-and-mouth disease virus [TaxId:12110] [111302] (4 PDB entries)
  8. 743433Domain d2d7sa1: 2d7s A:1-474 [131326]
    automatically matched to d1u09a_

Details for d2d7sa1

PDB Entry: 2d7s (more details), 3 Å

PDB Description: Foot and Mouth Disease Virus RNA-dependent RNA polymerase in complex with VPg protein
PDB Compounds: (A:) RNA-dpendent RNA polymerase

SCOP Domain Sequences for d2d7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7sa1 e.8.1.4 (A:1-474) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaale

SCOP Domain Coordinates for d2d7sa1:

Click to download the PDB-style file with coordinates for d2d7sa1.
(The format of our PDB-style files is described here.)

Timeline for d2d7sa1: