Lineage for d2d7pa1 (2d7p A:8-106)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659093Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
    Pfam PF00630
  6. 659125Protein Filamin C [117049] (1 species)
  7. 659126Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
  8. 659131Domain d2d7pa1: 2d7p A:8-106 [131324]
    22nd repeat

Details for d2d7pa1

PDB Entry: 2d7p (more details)

PDB Description: Solution structure of the 22th Filamin domain from human Filamin C
PDB Compounds: (A:) Filamin-C

SCOP Domain Sequences for d2d7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
sddarrltvtslqetglkvnqpasfavqlngargvidarvhtpsgaveecyvseldsdkh
tirfiphengvhsidvkfngahipgspfkirvgeqsqag

SCOP Domain Coordinates for d2d7pa1:

Click to download the PDB-style file with coordinates for d2d7pa1.
(The format of our PDB-style files is described here.)

Timeline for d2d7pa1: