Lineage for d2d7cd_ (2d7c D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709345Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 1709346Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 1709352Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)
  7. 1709353Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
    Uniprot O75154 703-756! Uniprot O75154 715-756
  8. 1709355Domain d2d7cd_: 2d7c D: [131320]
    Other proteins in same PDB: d2d7ca_, d2d7cb_
    automated match to d2d7cc1
    complexed with gtp, mes, mg

Details for d2d7cd_

PDB Entry: 2d7c (more details), 1.75 Å

PDB Description: crystal structure of human rab11 in complex with fip3 rab-binding domain
PDB Compounds: (D:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d2d7cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7cd_ h.1.31.1 (D:) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
vsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

SCOPe Domain Coordinates for d2d7cd_:

Click to download the PDB-style file with coordinates for d2d7cd_.
(The format of our PDB-style files is described here.)

Timeline for d2d7cd_: