Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) |
Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins) contains PfamB PB042332, PfamB PB026102 |
Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries) Uniprot O75154 703-756! Uniprot O75154 715-756 |
Domain d2d7cd_: 2d7c D: [131320] Other proteins in same PDB: d2d7ca_, d2d7cb_ automated match to d2d7cc1 complexed with gtp, mes, mg |
PDB Entry: 2d7c (more details), 1.75 Å
SCOPe Domain Sequences for d2d7cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d7cd_ h.1.31.1 (D:) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]} vsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk
Timeline for d2d7cd_: