Lineage for d2d6yb2 (2d6y B:75-192)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1746767Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1746768Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1746769Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1746920Protein Putative regulator SCO4008 [140883] (1 species)
  7. 1746921Species Streptomyces coelicolor [TaxId:1902] [140884] (1 PDB entry)
    Uniprot Q9ADP7 75-192
  8. 1746923Domain d2d6yb2: 2d6y B:75-192 [131316]
    Other proteins in same PDB: d2d6ya1, d2d6yb1
    automated match to d2d6ya2
    complexed with tla

Details for d2d6yb2

PDB Entry: 2d6y (more details), 2.3 Å

PDB Description: Crystal Structure of transcriptional factor SCO4008 from Streptomyces coelicolor A3(2)
PDB Compounds: (B:) putative tetR family regulatory protein

SCOPe Domain Sequences for d2d6yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6yb2 a.121.1.1 (B:75-192) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]}
pddiegwidrlldyhaahpellrllfwegmeygtaelpheaerqehyarkvaavrdgqer
gvitdaipapdllfllvamanwavvvpqmkrilvgggdagtdglrdsikkaarrivdr

SCOPe Domain Coordinates for d2d6yb2:

Click to download the PDB-style file with coordinates for d2d6yb2.
(The format of our PDB-style files is described here.)

Timeline for d2d6yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d6yb1