SCOPe 2.05: Domain d2d6yb1: 2d6y B:5-74

Lineage for d2d6yb1 (2d6y B:5-74)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative regulator SCO4008 [140203] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [140204] (1 PDB entry)
   Uniprot Q9ADP7 7-74

8. Domain d2d6yb1: 2d6y B:5-74 [131315]
   Other proteins in same PDB: d2d6ya2, d2d6yb2
   automated match to d2d6ya1
   complexed with tla

Details for d2d6yb1

PDB Entry: 2d6y, 2.3 Å

PDB Description: Crystal Structure of transcriptional factor SCO4008 from Streptomyces coelicolor A3(2)

PDB Compounds: (B:) putative tetR family regulatory protein

SCOPe Domain Sequences for d2d6yb1:

Sequence; same for both SEQRES and ATOM records:

>d2d6yb1 a.4.1.9 (B:5-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]}
dpeatkarifeaavaefarhgiagaridriaaearankqliyayygnkgelfasvlekkm
ldlaisvpvd

Timeline for d2d6yb1:

• d2d6yb1 first appeared in SCOP 1.73
  
• d2d6yb1 appears in SCOPe 2.04
  
• d2d6yb1 appears in SCOPe 2.06
  
• d2d6yb1 appears in the current release, SCOPe 2.08