Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Putative regulator SCO4008 [140203] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [140204] (1 PDB entry) Uniprot Q9ADP7 7-74 |
Domain d2d6yb1: 2d6y B:5-74 [131315] Other proteins in same PDB: d2d6ya2, d2d6yb2 automated match to d2d6ya1 complexed with tla |
PDB Entry: 2d6y (more details), 2.3 Å
SCOPe Domain Sequences for d2d6yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d6yb1 a.4.1.9 (B:5-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} dpeatkarifeaavaefarhgiagaridriaaearankqliyayygnkgelfasvlekkm ldlaisvpvd
Timeline for d2d6yb1: