Lineage for d2d6ya2 (2d6y A:75-192)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728071Protein Putative regulator SCO4008 [140883] (1 species)
  7. 2728072Species Streptomyces coelicolor [TaxId:1902] [140884] (1 PDB entry)
    Uniprot Q9ADP7 75-192
  8. 2728073Domain d2d6ya2: 2d6y A:75-192 [131314]
    Other proteins in same PDB: d2d6ya1, d2d6yb1
    complexed with tla

Details for d2d6ya2

PDB Entry: 2d6y (more details), 2.3 Å

PDB Description: Crystal Structure of transcriptional factor SCO4008 from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) putative tetR family regulatory protein

SCOPe Domain Sequences for d2d6ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6ya2 a.121.1.1 (A:75-192) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]}
pddiegwidrlldyhaahpellrllfwegmeygtaelpheaerqehyarkvaavrdgqer
gvitdaipapdllfllvamanwavvvpqmkrilvgggdagtdglrdsikkaarrivdr

SCOPe Domain Coordinates for d2d6ya2:

Click to download the PDB-style file with coordinates for d2d6ya2.
(The format of our PDB-style files is described here.)

Timeline for d2d6ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d6ya1