![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.4: GAD domain-like [55261] (2 families) ![]() |
![]() | Family d.74.4.1: GAD domain [55262] (2 proteins) has additional structures inserted in the common fold loops |
![]() | Protein Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain [143513] (2 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [143514] (1 PDB entry) Uniprot O26803 271-395 |
![]() | Domain d2d6fd2: 2d6f D:271-395 [131311] Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc1, d2d6fc3, d2d6fd1, d2d6fd3 automatically matched to 2D6F C:271-395 protein/RNA complex; complexed with zn |
PDB Entry: 2d6f (more details), 3.15 Å
SCOPe Domain Sequences for d2d6fd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d6fd2 d.74.4.1 (D:271-395) Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} avvedkifdvsevfadtesriissaesvlavklrgfdgligveiqpgrrlgtemadyakk rgvsgifhtdelpaygiteeevrglrdavgasqgdavvmvahervtaenalrevirraem aiqgv
Timeline for d2d6fd2: