Class a: All alpha proteins [46456] (285 folds) |
Fold a.182: GatB/YqeY motif [89094] (1 superfamily) multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical) |
Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) |
Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins) assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure |
Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain [140760] (2 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [140761] (1 PDB entry) Uniprot O26803 445-503 |
Domain d2d6fc1: 2d6f C:445-503 [131307] Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc2, d2d6fc3, d2d6fd2, d2d6fd3 protein/RNA complex; complexed with zn |
PDB Entry: 2d6f (more details), 3.15 Å
SCOPe Domain Sequences for d2d6fc1:
Sequence, based on SEQRES records: (download)
>d2d6fc1 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} elpsekkerimrdyglsedlasqlvkrnlvdefealtefrvdttviasllaytlrelrr
>d2d6fc1 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} elpsekkerimrdyglsedlasqlvkrnlvdefdttviasllaytlrelrr
Timeline for d2d6fc1: