Lineage for d2d6fa2 (2d6f A:84-435)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710029Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 710030Superfamily c.88.1: Glutaminase/Asparaginase [53774] (1 family) (S)
  5. 710031Family c.88.1.1: Glutaminase/Asparaginase [53775] (3 proteins)
  6. 710102Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [142776] (2 species)
  7. 710103Species Methanobacterium thermoautotrophicum [TaxId:145262] [142778] (1 PDB entry)
  8. 710104Domain d2d6fa2: 2d6f A:84-435 [131304]
    Other proteins in same PDB: d2d6fa1, d2d6fb1, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3
    complexed with zn

Details for d2d6fa2

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOP Domain Sequences for d2d6fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aaedpelpdvsiistggtvasiidyrtgavhpaftaddllranpelldianirgravfni
lsenmkpeywvetaravygeikdgadgvvvahgtdtmhytsaalsfmlrtpvpvvftgaq
rssdrpssdaslniqcsvraatseiaevtvcmhatmddlschlhrgvkvrkmhtsrrdtf
rsmnalplaevtpdgikileenyrkrgsdelelsdrveervafiksypgispdiikwhld
egyrgiviegtglghcpdtlipvigeahdmgvpvamtsqclngrvnmnvystgrrllqag
vipcddmlpevayvkmcwvlgqtddpemaremmreniageinertsiayfrg

SCOP Domain Coordinates for d2d6fa2:

Click to download the PDB-style file with coordinates for d2d6fa2.
(The format of our PDB-style files is described here.)

Timeline for d2d6fa2: