Lineage for d2d6ca_ (2d6c A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978189Protein Myoglobin [46469] (10 species)
  7. 1978334Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (267 PDB entries)
    Uniprot P02185
  8. 1978599Domain d2d6ca_: 2d6c A: [131301]
    automated match to d104m__
    complexed with hme, imd

Details for d2d6ca_

PDB Entry: 2d6c (more details), 2.26 Å

PDB Description: Crystal structure of myoglobin reconstituted with iron porphycene
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2d6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6ca_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2d6ca_:

Click to download the PDB-style file with coordinates for d2d6ca_.
(The format of our PDB-style files is described here.)

Timeline for d2d6ca_: