Lineage for d2d69e2 (2d69 E:9-133)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652842Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1652843Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1652844Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1652907Species Pyrococcus horikoshii [TaxId:53953] [143363] (2 PDB entries)
    Uniprot O58677 8-133
  8. 1652911Domain d2d69e2: 2d69 E:9-133 [131299]
    Other proteins in same PDB: d2d69a1, d2d69b1, d2d69d1, d2d69e1
    automated match to d2cwxa2
    complexed with so4

Details for d2d69e2

PDB Entry: 2d69 (more details), 1.9 Å

PDB Description: Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2d69e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d69e2 d.58.9.1 (E:9-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
ylrhf

SCOPe Domain Coordinates for d2d69e2:

Click to download the PDB-style file with coordinates for d2d69e2.
(The format of our PDB-style files is described here.)

Timeline for d2d69e2: