![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [143363] (2 PDB entries) Uniprot O58677 8-133 |
![]() | Domain d2d69b2: 2d69 B:8-133 [131295] Other proteins in same PDB: d2d69a1, d2d69b1, d2d69d1, d2d69e1 automated match to d2cwxa2 complexed with so4 |
PDB Entry: 2d69 (more details), 1.9 Å
SCOPe Domain Sequences for d2d69b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d69b2 d.58.9.1 (B:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]} vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakr smakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppy eylrhf
Timeline for d2d69b2: