SCOPe 2.08: Domain d2d69a2: 2d69 A:1-133

Lineage for d2d69a2 (2d69 A:1-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143363] (2 PDB entries)
   Uniprot O58677 8-133

8. Domain d2d69a2: 2d69 A:1-133 [131293]
   Other proteins in same PDB: d2d69a1, d2d69b1, d2d69d1, d2d69e1
   automated match to d2cwxa2
   complexed with so4

Details for d2d69a2

PDB Entry: 2d69, 1.9 Å

PDB Description: Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2d69a2:

Sequence; same for both SEQRES and ATOM records:

>d2d69a2 d.58.9.1 (A:1-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
mmvlrmkvewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwk
lpemakrsmakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrl
ldfhppyeylrhf

Timeline for d2d69a2:

• d2d69a2 first appeared in SCOP 1.73
  
• d2d69a2 appears in SCOPe 2.07