Lineage for d2d5xa_ (2d5x A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473500Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries)
  8. 1473501Domain d2d5xa_: 2d5x A: [131282]
    Other proteins in same PDB: d2d5xb_
    automated match to d1iwha_
    complexed with cmo, hem, l35

Details for d2d5xa_

PDB Entry: 2d5x (more details), 1.45 Å

PDB Description: Crystal structure of carbonmonoxy horse hemoglobin complexed with L35
PDB Compounds: (A:) Hemoglobin alpha subunit

SCOPe Domain Sequences for d2d5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5xa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d2d5xa_:

Click to download the PDB-style file with coordinates for d2d5xa_.
(The format of our PDB-style files is described here.)

Timeline for d2d5xa_: