Lineage for d2d5xa1 (2d5x A:1-141)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631914Species Horse (Equus caballus) [TaxId:9796] [46488] (9 PDB entries)
  8. 631915Domain d2d5xa1: 2d5x A:1-141 [131282]
    Other proteins in same PDB: d2d5xb1
    automatically matched to d1iwha_
    complexed with cmo, hem, l35

Details for d2d5xa1

PDB Entry: 2d5x (more details), 1.45 Å

PDB Description: Crystal structure of carbonmonoxy horse hemoglobin complexed with L35
PDB Compounds: (A:) Hemoglobin alpha subunit

SCOP Domain Sequences for d2d5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5xa1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d2d5xa1:

Click to download the PDB-style file with coordinates for d2d5xa1.
(The format of our PDB-style files is described here.)

Timeline for d2d5xa1: