SCOP 1.73: Domain d2d5xa1: 2d5x A:1-141

Lineage for d2d5xa1 (2d5x A:1-141)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (9 PDB entries)

8. Domain d2d5xa1: 2d5x A:1-141 [131282]
   Other proteins in same PDB: d2d5xb1
   automatically matched to d1iwha_
   complexed with cmo, hem, l35

Details for d2d5xa1

PDB Entry: 2d5x, 1.45 Å

PDB Description: Crystal structure of carbonmonoxy horse hemoglobin complexed with L35

PDB Compounds: (A:) Hemoglobin alpha subunit

SCOP Domain Sequences for d2d5xa1:

Sequence; same for both SEQRES and ATOM records:

>d2d5xa1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d2d5xa1:

• d2d5xa1 is new in SCOP 1.73
  
• d2d5xa1 appears in SCOP 1.75
  
• d2d5xa1 appears in the current release, SCOPe 2.08, called d2d5xa_