SCOPe 2.08: Domain d2d5xa_: 2d5x A:

Lineage for d2d5xa_ (2d5x A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)

8. Domain d2d5xa_: 2d5x A: [131282]
   Other proteins in same PDB: d2d5xb_
   automated match to d1iwha_
   complexed with cmo, hem, l35

Details for d2d5xa_

PDB Entry: 2d5x, 1.45 Å

PDB Description: Crystal structure of carbonmonoxy horse hemoglobin complexed with L35

PDB Compounds: (A:) Hemoglobin alpha subunit

SCOPe Domain Sequences for d2d5xa_:

Sequence; same for both SEQRES and ATOM records:

>d2d5xa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d2d5xa_:

• d2d5xa_ first appeared in SCOP 1.73, called d2d5xa1
  
• d2d5xa_ appears in SCOPe 2.07