Lineage for d2d5ua1 (2d5u A:6-124)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882421Fold d.314: PUG domain-like [143502] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(2)-alpha; cluster of helices with a small antiparallel beta-sheet on one side; order 132; topological similarity to the fold of an extended R3H domain (PDB 1whr)
  4. 882422Superfamily d.314.1: PUG domain-like [143503] (1 family) (S)
  5. 882423Family d.314.1.1: PUG domain [143504] (1 protein)
    SMART 00580; domain in protein kinases, N-glycanases and other nuclear proteins
  6. 882424Protein N-glycanase 1, N-terminal domain [143505] (2 species)
  7. 882428Species Mouse (Mus musculus) [TaxId:10090] [143506] (1 PDB entry)
    Uniprot Q9JI78 1-119
  8. 882429Domain d2d5ua1: 2d5u A:6-124 [131281]

Details for d2d5ua1

PDB Entry: 2d5u (more details)

PDB Description: solution structure of the n-terminal portion of the pub domain of mouse peptide:n-glycanase
PDB Compounds: (A:) N-glycanase 1

SCOP Domain Sequences for d2d5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ua1 d.314.1.1 (A:6-124) N-glycanase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
masatlgsssssaspavaelcqntpetfleaskllltyadnilrnpsdekyrsirignta
fstrllpvrgaveclfemgfeegethlifpkkasveqlqkirdliaierssrldgsskk

SCOP Domain Coordinates for d2d5ua1:

Click to download the PDB-style file with coordinates for d2d5ua1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ua1: