SCOPe 2.05: Domain d2d5nd2: 2d5n D:0-145

Lineage for d2d5nd2 (2d5n D:0-145)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Riboflavin biosynthesis protein RibD [142837] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
   Uniprot P17618 1-145

8. Domain d2d5nd2: 2d5n D:0-145 [131280]
   Other proteins in same PDB: d2d5na1, d2d5nb1, d2d5nc1, d2d5nd1
   automated match to d2b3za2
   complexed with ndp, zn

Details for d2d5nd2

PDB Entry: 2d5n, 2.97 Å

PDB Description: Crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (D:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2d5nd2:

Sequence; same for both SEQRES and ATOM records:

>d2d5nd2 c.97.1.2 (D:0-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
smeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmag
ahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagi
evregiladqaerlnekflhfmrtgl

Timeline for d2d5nd2:

• d2d5nd2 first appeared in SCOP 1.73
  
• d2d5nd2 appears in SCOPe 2.04
  
• d2d5nd2 appears in SCOPe 2.06
  
• d2d5nd2 appears in the current release, SCOPe 2.08