SCOP 1.73: Domain d2d5nd1: 2d5n D:146-359

Lineage for d2d5nd1 (2d5n D:146-359)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (2 proteins)
   Pfam PF01872

6. Protein Riboflavin biosynthesis protein RibD [142702] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142703] (2 PDB entries)

8. Domain d2d5nd1: 2d5n D:146-359 [131279]
   Other proteins in same PDB: d2d5na2, d2d5nb2, d2d5nc2, d2d5nd2
   automatically matched to 2B3Z A:146-359
   complexed with ndp, zn

Details for d2d5nd1

PDB Entry: 2d5n, 2.97 Å

PDB Description: Crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (D:) Riboflavin biosynthesis protein ribD

SCOP Domain Sequences for d2d5nd1:

Sequence; same for both SEQRES and ATOM records:

>d2d5nd1 c.71.1.2 (D:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

Timeline for d2d5nd1:

• d2d5nd1 is new in SCOP 1.73
  
• d2d5nd1 appears in SCOP 1.75
  
• d2d5nd1 appears in the current release, SCOPe 2.08