Lineage for d2d5nc2 (2d5n C:1-145)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010298Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1010299Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1010374Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 1010408Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
  7. 1010409Species Bacillus subtilis [TaxId:1423] [142838] (2 PDB entries)
    Uniprot P17618 1-145
  8. 1010416Domain d2d5nc2: 2d5n C:1-145 [131278]
    Other proteins in same PDB: d2d5na1, d2d5nb1, d2d5nc1, d2d5nd1
    automatically matched to 2B3Z A:1-145
    complexed with ndp, zn

Details for d2d5nc2

PDB Entry: 2d5n (more details), 2.97 Å

PDB Description: Crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis
PDB Compounds: (C:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2d5nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5nc2 c.97.1.2 (C:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

SCOPe Domain Coordinates for d2d5nc2:

Click to download the PDB-style file with coordinates for d2d5nc2.
(The format of our PDB-style files is described here.)

Timeline for d2d5nc2: