![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) ![]() |
![]() | Family c.71.1.2: RibD C-terminal domain-like [142701] (2 proteins) Pfam PF01872 |
![]() | Protein Riboflavin biosynthesis protein RibD [142702] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142703] (2 PDB entries) Uniprot P17618 146-359 |
![]() | Domain d2d5nc1: 2d5n C:146-359 [131277] Other proteins in same PDB: d2d5na2, d2d5nb2, d2d5nc2, d2d5nd2 automatically matched to 2B3Z A:146-359 complexed with ndp, zn |
PDB Entry: 2d5n (more details), 2.97 Å
SCOP Domain Sequences for d2d5nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5nc1 c.71.1.2 (C:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl isgegfqsmkdvpllqftditqigrdikltakpt
Timeline for d2d5nc1: