SCOPe 2.08: Domain d2d5nc1: 2d5n C:146-359

Lineage for d2d5nc1 (2d5n C:146-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
   Pfam PF01872

6. Protein Riboflavin biosynthesis protein RibD [142702] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries)
   Uniprot P17618 146-359

8. Domain d2d5nc1: 2d5n C:146-359 [131277]
   Other proteins in same PDB: d2d5na2, d2d5nb2, d2d5nc2, d2d5nd2, d2d5nd3
   automated match to d2b3za1
   complexed with ndp, zn

Details for d2d5nc1

PDB Entry: 2d5n, 2.97 Å

PDB Description: Crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (C:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2d5nc1:

Sequence; same for both SEQRES and ATOM records:

>d2d5nc1 c.71.1.2 (C:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

Timeline for d2d5nc1:

• d2d5nc1 first appeared in SCOP 1.73
  
• d2d5nc1 appears in SCOPe 2.07