Lineage for d2d5nb1 (2d5n B:146-359)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904001Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
    Pfam PF01872
  6. 2904005Protein Riboflavin biosynthesis protein RibD [142702] (2 species)
  7. 2904006Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries)
    Uniprot P17618 146-359
  8. 2904016Domain d2d5nb1: 2d5n B:146-359 [131275]
    Other proteins in same PDB: d2d5na2, d2d5nb2, d2d5nc2, d2d5nd2, d2d5nd3
    automated match to d2b3za1
    complexed with ndp, zn

Details for d2d5nb1

PDB Entry: 2d5n (more details), 2.97 Å

PDB Description: Crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis
PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2d5nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5nb1 c.71.1.2 (B:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

SCOPe Domain Coordinates for d2d5nb1:

Click to download the PDB-style file with coordinates for d2d5nb1.
(The format of our PDB-style files is described here.)

Timeline for d2d5nb1: