SCOP 1.73: Domain d2d5na2: 2d5n A:1-145

Lineage for d2d5na2 (2d5n A:1-145)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
   strand 5 is parallel to strand 4

6. Protein Riboflavin biosynthesis protein RibD [142837] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142838] (2 PDB entries)

8. Domain d2d5na2: 2d5n A:1-145 [131274]
   Other proteins in same PDB: d2d5na1, d2d5nb1, d2d5nc1, d2d5nd1
   automatically matched to 2B3Z A:1-145
   complexed with ndp, zn

Details for d2d5na2

PDB Entry: 2d5n, 2.97 Å

PDB Description: Crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOP Domain Sequences for d2d5na2:

Sequence; same for both SEQRES and ATOM records:

>d2d5na2 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

Timeline for d2d5na2:

• d2d5na2 is new in SCOP 1.73
  
• d2d5na2 appears in SCOP 1.75
  
• d2d5na2 appears in the current release, SCOPe 2.08