Lineage for d2d5jb_ (2d5j B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722252Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (2 proteins)
    Pfam PF07470
  6. 2722261Protein automated matches [190261] (1 species)
    not a true protein
  7. 2722262Species Bacillus sp. [TaxId:84635] [187050] (3 PDB entries)
  8. 2722266Domain d2d5jb_: 2d5j B: [131272]
    automated match to d1vd5a_

Details for d2d5jb_

PDB Entry: 2d5j (more details), 1.6 Å

PDB Description: Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond
PDB Compounds: (B:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d2d5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5jb_ a.102.1.7 (B:) automated matches {Bacillus sp. [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOPe Domain Coordinates for d2d5jb_:

Click to download the PDB-style file with coordinates for d2d5jb_.
(The format of our PDB-style files is described here.)

Timeline for d2d5jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d5ja_