Lineage for d2d5ja1 (2d5j A:1-377)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774163Superfamily a.102.1: Six-hairpin glycosidases [48208] (9 families) (S)
  5. 774304Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (1 protein)
    Pfam PF07470
  6. 774305Protein Unsaturated glucuronyl hydrolase [109954] (1 species)
  7. 774306Species Bacillus sp. GL1 [TaxId:84635] [109955] (3 PDB entries)
    Uniprot Q9RC92
  8. 774307Domain d2d5ja1: 2d5j A:1-377 [131271]
    automatically matched to d1vd5a_

Details for d2d5ja1

PDB Entry: 2d5j (more details), 1.6 Å

PDB Description: Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOP Domain Sequences for d2d5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOP Domain Coordinates for d2d5ja1:

Click to download the PDB-style file with coordinates for d2d5ja1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d5jb1