Lineage for d2d5ia1 (2d5i A:1-200)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692068Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 692069Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 692070Species Escherichia coli [TaxId:562] [110471] (3 PDB entries)
  8. 692072Domain d2d5ia1: 2d5i A:1-200 [131270]
    automatically matched to d1tika_
    complexed with fmn, gol

Details for d2d5ia1

PDB Entry: 2d5i (more details), 2.2 Å

PDB Description: The crystal structure of AzoR (Azo Reductase) from Escherichia coli
PDB Compounds: (A:) Azo Reductase

SCOP Domain Sequences for d2d5ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ia1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]}
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
emaakaqsdakaaidsivsa

SCOP Domain Coordinates for d2d5ia1:

Click to download the PDB-style file with coordinates for d2d5ia1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ia1: