Lineage for d2d5ba2 (2d5b A:1-348)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590101Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1590329Protein automated matches [190581] (8 species)
    not a true protein
  7. 1590361Species Thermus thermophilus [TaxId:274] [254946] (3 PDB entries)
  8. 1590362Domain d2d5ba2: 2d5b A:1-348 [131269]
    Other proteins in same PDB: d2d5ba1
    automated match to d1a8ha2
    complexed with zn; mutant

Details for d2d5ba2

PDB Entry: 2d5b (more details), 1.8 Å

PDB Description: crystal structure of thermus thermophilus methionyl trna synthetase y225f mutant obtained in the presence of peg6000
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2d5ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ba2 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus [TaxId: 274]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtfvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

SCOPe Domain Coordinates for d2d5ba2:

Click to download the PDB-style file with coordinates for d2d5ba2.
(The format of our PDB-style files is described here.)

Timeline for d2d5ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d5ba1