Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein automated matches [190581] (8 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [254946] (3 PDB entries) |
Domain d2d5ba2: 2d5b A:1-348 [131269] Other proteins in same PDB: d2d5ba1 automated match to d1a8ha2 complexed with zn; mutant |
PDB Entry: 2d5b (more details), 1.8 Å
SCOPe Domain Sequences for d2d5ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5ba2 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus [TaxId: 274]} mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtfvwfdallnyvsaldy pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead
Timeline for d2d5ba2: