Lineage for d2d5ba1 (2d5b A:349-500)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993200Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1993201Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1993254Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1993255Protein automated matches [226872] (8 species)
    not a true protein
  7. 1993272Species Thermus thermophilus [TaxId:274] [254947] (3 PDB entries)
  8. 1993273Domain d2d5ba1: 2d5b A:349-500 [131268]
    Other proteins in same PDB: d2d5ba2
    automated match to d2d5ba1
    complexed with zn; mutant

Details for d2d5ba1

PDB Entry: 2d5b (more details), 1.8 Å

PDB Description: crystal structure of thermus thermophilus methionyl trna synthetase y225f mutant obtained in the presence of peg6000
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2d5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ba1 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

SCOPe Domain Coordinates for d2d5ba1:

Click to download the PDB-style file with coordinates for d2d5ba1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d5ba2