Lineage for d2d5ba1 (2d5b A:349-500)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639677Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 639678Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 639679Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 639708Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 639721Species Thermus thermophilus [TaxId:274] [47326] (4 PDB entries)
  8. 639722Domain d2d5ba1: 2d5b A:349-500 [131268]
    Other proteins in same PDB: d2d5ba2
    automatically matched to d1a8h_1
    complexed with zn; mutant

Details for d2d5ba1

PDB Entry: 2d5b (more details), 1.8 Å

PDB Description: crystal structure of thermus thermophilus methionyl trna synthetase y225f mutant obtained in the presence of peg6000
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOP Domain Sequences for d2d5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ba1 a.27.1.1 (A:349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

SCOP Domain Coordinates for d2d5ba1:

Click to download the PDB-style file with coordinates for d2d5ba1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d5ba2