Lineage for d2d5aa1 (2d5a A:1-142)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688570Family c.2.1.8: CoA-binding domain [51900] (5 protein domains)
  6. 688578Protein Hypothetical protein PH1109 [141934] (1 species)
  7. 688579Species Pyrococcus horikoshii [TaxId:53953] [141935] (3 PDB entries)
  8. 688581Domain d2d5aa1: 2d5a A:1-142 [131267]
    automatically matched to 2CZZ X:1-142
    complexed with coa

Details for d2d5aa1

PDB Entry: 2d5a (more details), 1.7 Å

PDB Description: hypothetical protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH1109

SCOP Domain Sequences for d2d5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5aa1 c.2.1.8 (A:1-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]}
meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
deagliivanrcmmreherllg

SCOP Domain Coordinates for d2d5aa1:

Click to download the PDB-style file with coordinates for d2d5aa1.
(The format of our PDB-style files is described here.)

Timeline for d2d5aa1: