Lineage for d2d59a1 (2d59 A:4-142)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688570Family c.2.1.8: CoA-binding domain [51900] (5 proteins)
  6. 688578Protein Hypothetical protein PH1109 [141934] (1 species)
  7. 688579Species Pyrococcus horikoshii [TaxId:53953] [141935] (3 PDB entries)
  8. 688580Domain d2d59a1: 2d59 A:4-142 [131266]
    automatically matched to 2CZZ X:1-142

Details for d2d59a1

PDB Entry: 2d59 (more details), 1.65 Å

PDB Description: hypothetical protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) hypothetical protein PH1109

SCOP Domain Sequences for d2d59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]}
trpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkyeevl
grkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskkadea
gliivanrcmmreherllg

SCOP Domain Coordinates for d2d59a1:

Click to download the PDB-style file with coordinates for d2d59a1.
(The format of our PDB-style files is described here.)

Timeline for d2d59a1: