![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein automated matches [190581] (8 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [254946] (3 PDB entries) |
![]() | Domain d2d54a2: 2d54 A:1-348 [131265] Other proteins in same PDB: d2d54a1 automated match to d1a8ha2 complexed with zn; mutant |
PDB Entry: 2d54 (more details), 2 Å
SCOPe Domain Sequences for d2d54a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d54a2 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus [TaxId: 274]} mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtavwfdallnyvsaldy pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead
Timeline for d2d54a2: