SCOPe 2.08: Domain d2d54a2: 2d54 A:1-348

Lineage for d2d54a2 (2d54 A:1-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein automated matches [190581] (10 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [254946] (3 PDB entries)

8. Domain d2d54a2: 2d54 A:1-348 [131265]
   Other proteins in same PDB: d2d54a1
   automated match to d1a8ha2
   complexed with zn; mutant

Details for d2d54a2

PDB Entry: 2d54, 2 Å

PDB Description: crystal structure of methionyl trna synthetase y225a mutant from thermus thermophilus

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2d54a2:

Sequence; same for both SEQRES and ATOM records:

>d2d54a2 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus [TaxId: 274]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtavwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

Timeline for d2d54a2:

• d2d54a2 first appeared in SCOP 1.73
  
• d2d54a2 appears in SCOPe 2.07