![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
![]() | Protein automated matches [226872] (13 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [254947] (3 PDB entries) |
![]() | Domain d2d54a1: 2d54 A:349-500 [131264] Other proteins in same PDB: d2d54a2 automated match to d2d5ba1 complexed with zn; mutant |
PDB Entry: 2d54 (more details), 2 Å
SCOPe Domain Sequences for d2d54a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d54a1 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus [TaxId: 274]} laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg lkeevrleeaerwglaeprpipeeapvlfpkk
Timeline for d2d54a1: