Lineage for d2d4rd_ (2d4r D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218513Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins)
    Pfam PF03654
  6. 1218526Protein automated matches [190593] (1 species)
    not a true protein
  7. 1218527Species Thermus thermophilus [TaxId:300852] [187605] (1 PDB entry)
  8. 1218530Domain d2d4rd_: 2d4r D: [131259]
    Other proteins in same PDB: d2d4ra1
    automated match to d2d4ra1
    complexed with so4

Details for d2d4rd_

PDB Entry: 2d4r (more details), 2.4 Å

PDB Description: Crystal structure of TTHA0849 from Thermus thermophilus HB8
PDB Compounds: (D:) hypothetical protein TTHA0849

SCOPe Domain Sequences for d2d4rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4rd_ d.129.3.6 (D:) automated matches {Thermus thermophilus [TaxId: 300852]}
pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
lvqklmqenvesllkgleervlaass

SCOPe Domain Coordinates for d2d4rd_:

Click to download the PDB-style file with coordinates for d2d4rd_.
(The format of our PDB-style files is described here.)

Timeline for d2d4rd_: