![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins) Pfam PF03654 |
![]() | Protein automated matches [190593] (1 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187605] (1 PDB entry) |
![]() | Domain d2d4rd_: 2d4r D: [131259] Other proteins in same PDB: d2d4ra1 automated match to d2d4ra1 complexed with so4 |
PDB Entry: 2d4r (more details), 2.4 Å
SCOPe Domain Sequences for d2d4rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4rd_ d.129.3.6 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk lvqklmqenvesllkgleervlaass
Timeline for d2d4rd_: