SCOP 1.73: Domain d2d4rc1: 2d4r C:2-146

Lineage for d2d4rc1 (2d4r C:2-146)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (2 proteins)
   Pfam PF03654

6. Protein Hypothetical protein TTHA0849 [143837] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143838] (1 PDB entry)

8. Domain d2d4rc1: 2d4r C:2-146 [131258]
   automatically matched to 2D4R A:2-147
   complexed with so4

Details for d2d4rc1

PDB Entry: 2d4r, 2.4 Å

PDB Description: Crystal structure of TTHA0849 from Thermus thermophilus HB8

PDB Compounds: (C:) hypothetical protein TTHA0849

SCOP Domain Sequences for d2d4rc1:

Sequence; same for both SEQRES and ATOM records:

>d2d4rc1 d.129.3.6 (C:2-146) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]}
pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
lvqklmqenvesllkgleervlaas

Timeline for d2d4rc1:

• d2d4rc1 is new in SCOP 1.73
  
• d2d4rc1 appears in SCOP 1.75
  
• d2d4rc1 appears in the current release, SCOPe 2.08, called d2d4rc_