SCOPe 2.08: Domain d2d4rb_: 2d4r B:

Lineage for d2d4rb_ (2d4r B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins)
   Pfam PF03654

6. Protein automated matches [190593] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187605] (1 PDB entry)

8. Domain d2d4rb_: 2d4r B: [131257]
   Other proteins in same PDB: d2d4ra1
   automated match to d2d4ra1
   complexed with so4

Details for d2d4rb_

PDB Entry: 2d4r, 2.4 Å

PDB Description: Crystal structure of TTHA0849 from Thermus thermophilus HB8

PDB Compounds: (B:) hypothetical protein TTHA0849

SCOPe Domain Sequences for d2d4rb_:

Sequence; same for both SEQRES and ATOM records:

>d2d4rb_ d.129.3.6 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
lvqklmqenvesllkgleervlaass

Timeline for d2d4rb_:

• d2d4rb_ first appeared in SCOP 1.73, called d2d4rb1
  
• d2d4rb_ appears in SCOPe 2.07