Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins) Pfam PF03654 |
Protein Hypothetical protein TTHA0849 [143837] (1 species) |
Species Thermus thermophilus [TaxId:274] [143838] (1 PDB entry) Uniprot Q5SK03 2-147 |
Domain d2d4ra1: 2d4r A:2-147 [131256] Other proteins in same PDB: d2d4rb_, d2d4rc_, d2d4rd_ complexed with so4 |
PDB Entry: 2d4r (more details), 2.4 Å
SCOPe Domain Sequences for d2d4ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk lvqklmqenvesllkgleervlaass
Timeline for d2d4ra1: