Lineage for d2d4ra1 (2d4r A:2-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215181Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins)
    Pfam PF03654
  6. 2215185Protein Hypothetical protein TTHA0849 [143837] (1 species)
  7. 2215186Species Thermus thermophilus [TaxId:274] [143838] (1 PDB entry)
    Uniprot Q5SK03 2-147
  8. 2215187Domain d2d4ra1: 2d4r A:2-147 [131256]
    Other proteins in same PDB: d2d4rb_, d2d4rc_, d2d4rd_
    complexed with so4

Details for d2d4ra1

PDB Entry: 2d4r (more details), 2.4 Å

PDB Description: Crystal structure of TTHA0849 from Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TTHA0849

SCOPe Domain Sequences for d2d4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]}
pevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvr
wleeeewddenlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrk
lvqklmqenvesllkgleervlaass

SCOPe Domain Coordinates for d2d4ra1:

Click to download the PDB-style file with coordinates for d2d4ra1.
(The format of our PDB-style files is described here.)

Timeline for d2d4ra1: