Lineage for d2d4cd1 (2d4c D:12-247)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651573Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 651574Superfamily a.238.1: BAR/IMD domain-like [103657] (3 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 651575Family a.238.1.1: BAR domain [103658] (2 proteins)
    sensor of membrane curvature
  6. 651579Protein Endophilin-1 [140699] (3 species)
    SH3-containing GRB2-like protein 2
  7. 651580Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries)
  8. 651584Domain d2d4cd1: 2d4c D:12-247 [131249]
    automatically matched to 2D4C A:11-247
    complexed with ca; mutant

Details for d2d4cd1

PDB Entry: 2d4c (more details), 2.4 Å

PDB Description: Crystal structure of the endophilin BAR domain mutant
PDB Compounds: (D:) sh3-containing grb2-like protein 2

SCOP Domain Sequences for d2d4cd1:

Sequence, based on SEQRES records: (download)

>d2d4cd1 a.238.1.1 (D:12-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
katqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmi
ntmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsl
dievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqal
ekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer

Sequence, based on observed residues (ATOM records): (download)

>d2d4cd1 a.238.1.1 (D:12-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
katqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmy
pqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnl
hdkdlreiqsalqhhlkklegrrldfdipdeelrqalekfdeskeiaessmfnllemdie
qvsqlsalvqaqleyhkqavqilqqvtvrleer

SCOP Domain Coordinates for d2d4cd1:

Click to download the PDB-style file with coordinates for d2d4cd1.
(The format of our PDB-style files is described here.)

Timeline for d2d4cd1: