Class a: All alpha proteins [46456] (258 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (3 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.1: BAR domain [103658] (2 proteins) sensor of membrane curvature |
Protein Endophilin-1 [140699] (3 species) SH3-containing GRB2-like protein 2 |
Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries) |
Domain d2d4cb1: 2d4c B:11-247 [131247] automatically matched to 2D4C A:11-247 complexed with ca; mutant |
PDB Entry: 2d4c (more details), 2.4 Å
SCOP Domain Sequences for d2d4cb1:
Sequence, based on SEQRES records: (download)
>d2d4cb1 a.238.1.1 (B:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsm intmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkds ldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqa lekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer
>d2d4cb1 a.238.1.1 (B:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsm ipgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidp lqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiae ssmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer
Timeline for d2d4cb1: