| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.39: Penicillinase repressor [101016] (4 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain automatically mapped to Pfam PF03965 |
| Protein Methicillin resistance regulatory protein MecI [101017] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries) |
| Domain d2d45b1: 2d45 B:5-121 [131243] automatically matched to d1okrb_ protein/DNA complex |
PDB Entry: 2d45 (more details), 3.8 Å
SCOPe Domain Sequences for d2d45b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d45b1 a.4.5.39 (B:5-121) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrniln
Timeline for d2d45b1: