SCOP 1.75: Domain d2d45b1: 2d45 B:5-121

Lineage for d2d45b1 (2d45 B:5-121)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (3 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain

6. Protein Methicillin resistance regulatory protein MecI [101017] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)

8. Domain d2d45b1: 2d45 B:5-121 [131243]
   automatically matched to d1okrb_

Details for d2d45b1

PDB Entry: 2d45, 3.8 Å

PDB Description: Crystal structure of the MecI-mecA repressor-operator complex

PDB Compounds: (B:) Methicillin resistance regulatory protein mecI

SCOP Domain Sequences for d2d45b1:

Sequence; same for both SEQRES and ATOM records:

>d2d45b1 a.4.5.39 (B:5-121) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrniln

Timeline for d2d45b1:

• d2d45b1 first appeared in SCOP 1.73
  
• d2d45b1 appears in SCOPe 2.01
  
• d2d45b1 appears in the current release, SCOPe 2.08