Lineage for d2d45b1 (2d45 B:5-121)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635674Family a.4.5.39: Penicillinase repressor [101016] (2 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
  6. 635675Protein Methicillin resistance regulatory protein MecI [101017] (1 species)
  7. 635676Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)
  8. 635686Domain d2d45b1: 2d45 B:5-121 [131243]
    automatically matched to d1okrb_

Details for d2d45b1

PDB Entry: 2d45 (more details), 3.8 Å

PDB Description: Crystal structure of the MecI-mecA repressor-operator complex
PDB Compounds: (B:) Methicillin resistance regulatory protein mecI

SCOP Domain Sequences for d2d45b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d45b1 a.4.5.39 (B:5-121) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrniln

SCOP Domain Coordinates for d2d45b1:

Click to download the PDB-style file with coordinates for d2d45b1.
(The format of our PDB-style files is described here.)

Timeline for d2d45b1: