SCOPe 2.06: Domain d2d45a1: 2d45 A:5-121

Lineage for d2d45a1 (2d45 A:5-121)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
   automatically mapped to Pfam PF03965

6. Protein Methicillin resistance regulatory protein MecI [101017] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)

8. Domain d2d45a1: 2d45 A:5-121 [131242]
   automatically matched to d1okrb_
   protein/DNA complex

Details for d2d45a1

PDB Entry: 2d45, 3.8 Å

PDB Description: Crystal structure of the MecI-mecA repressor-operator complex

PDB Compounds: (A:) Methicillin resistance regulatory protein mecI

SCOPe Domain Sequences for d2d45a1:

Sequence; same for both SEQRES and ATOM records:

>d2d45a1 a.4.5.39 (A:5-121) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrniln

Timeline for d2d45a1:

• d2d45a1 first appeared in SCOP 1.73
  
• d2d45a1 appears in SCOPe 2.05
  
• d2d45a1 appears in SCOPe 2.07
  
• d2d45a1 appears in the current release, SCOPe 2.08